Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase III
LigandBDBM50429899
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1441635
Kd 29000±n/a nM
Citation Dudutiene VMatuliene JSmirnov ATimm DDZubriene ABaranauskiene LMorkunaite VSmirnoviene JMichailoviene VJuozapaitiene VMickeviciute AKazokaite JBak?yte SKasiliauskaite AJachno JRevuckiene JKi?onaite MPilipuityte VIvanauskaite EMilinaviciute GSmirnovas VPetrikaite VKairys VPetrauskas VNorvai?as PLinge DGibie?a PCapkauskaite EZak?auskas AKazlauskas EManakova EGra?ulis SLadbury JEMatulis D Discovery and characterization of novel selective inhibitors of carbonic anhydrase IX. J Med Chem 57:9435-46 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase III
Name:Carbonic Anhydrase III
Synonyms:CA-III | Carbonate dehydratase III | Carbonic anhydrase 3 (CA III) | Carbonic anhydrase III (CA III)
Type:Enzyme
Mol. Mass.:29562.11
Organism:Homo sapiens (Human)
Description:Human cloned isozyme.
Residue:260
Sequence:
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDP
SCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPL
VSNWRPPQPINNRVVRASFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50429899
n/a
NameBDBM50429899
Synonyms:CHEMBL2333416
TypeSmall organic molecule
Emp. Form.C8H7F4NO3S2
Mol. Mass.305.27
SMILESNS(=O)(=O)c1c(F)c(F)c(SCCO)c(F)c1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: