Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 7
LigandBDBM50032605
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1440940
IC50 39±n/a nM
Citation Kawai KEndo YAsano TAmano SSawada KUeo NTakahashi NSonoda YNagai MKamei NNagata N Discovery of 2-(cyclopentylamino)thieno[3,2-d]pyrimidin-4(3H)-one derivatives as a new series of potent phosphodiesterase 7 inhibitors. J Med Chem 57:9844-54 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 7
Name:3',5'-cyclic phosphodiesterase
Synonyms:Phosphodiesterase 7 (PDE7) | Phosphodiesterase 7A | Phosphodiesterase 7A (PDE7A1)
Type:Enzyme
Mol. Mass.:55514.96
Organism:Homo sapiens (Human)
Description:Q13946
Residue:482
Sequence:
MEVCYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPNPRQLSQRRGAISYDSSDQTA
LYIRMLGDVRVRSRAGFESERRGSHPYIDFRIFHSQSEIEVSVSARNIRRLLSFQRYLRS
SRFFRGTAVSNSLNILDDDYNGQAKCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSL
HGLIEYFHLDMMKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLANSVTPW
DILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFS
HLPLESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLCLEDTRHRHLVLQMALKC
ADICNPCRTWELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRHTESIANIQIGFMTYL
VEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGLQREQSSSEDTDAAFELNSQLLPQENR
LS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50032605
n/a
NameBDBM50032605
Synonyms:CHEMBL3354174
TypeSmall organic molecule
Emp. Form.C20H30N4O2S
Mol. Mass.390.543
SMILESCCn1c(NC2CCCC2)nc2c(CCCN3CCOCC3)csc2c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: