Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeregrin
LigandBDBM50032922
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1431805
IC50 316±n/a nM
Citation Demont EHBamborough PChung CWCraggs PDFallon DGordon LJGrandi PHobbs CIHussain JJones EJLe Gall AMichon AMMitchell DJPrinjha RKRoberts ADSheppard RJWatson RJ 1,3-Dimethyl Benzimidazolones Are Potent, Selective Inhibitors of the BRPF1 Bromodomain. ACS Med Chem Lett 5:1190-5 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peregrin
Name:Peregrin
Synonyms:BR140 | BRPF1 | Bromodomain and PHD finger-containing protein 1 | Peregrin | Protein Br140
Type:PROTEIN
Mol. Mass.:137524.47
Organism:Homo sapiens (Human)
Description:ChEMBL_108054
Residue:1214
Sequence:
MGVDFDVKTFCHNLRATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDNPPPPQQTPLRK
HKKKGRQSRPANKQSPSPSEVSQSPGREVMSYAQAQRMVEVDLHGRVHRISIFDNLDVVS
EDEEAPEEAPENGSNKENTETPAATPKSGKHKNKEKRKDSNHHHHHNVSASTTPKLPEVV
YRELEQDTPDAPPRPTSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMNERRKTEGVSPI
PQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICNDGECQNSNVILFCDMCNLAV
HQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEV
CFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLY
MKMEPVRETGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEDEDEEEDEGKGWSS
EKVKKAKAKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRL
HSYWTLKRQSRNGVPLLRRLQTHLQSQRNCDQVGRDSEDKNWALKEQLKSWQRLRHDLER
ARLLVELIRKREKLKRETIKVQQIAMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLS
EVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVR
LREQGGAVLRQARRQAEKMGIDFETGMHIPHSLAGDEATHHTEDAAEEERLVLLENQKHL
PVEEQLKLLLERLDEVNASKQSVGRSRRAKMIKKEMTALRRKLAHQRETGRDGPERHGPS
SRGSLTPHPAACDKDGQTDSAAEESSSQETSKGLGPNMSSTPAHEVGRRTSVLFSKKNPK
TAGPPKRPGRPPKNRESQMTPSHGGSPVGPPQLPIMSSLRQRKRGRSPRPSSSSDSDSDK
STEDPPMDLPANGFSGGNQPVKKSFLVYRNDCSLPRSSSDSESSSSSSSSAASDRTSTTP
SKQGRGKPSFSRGTFPEDSSEDTSGTENEAYSVGTGRGVGHSMVRKSLGRGAGWLSEDED
SPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEARE
HLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRS
KVQGEQSSETSDSD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50032922
n/a
NameBDBM50032922
Synonyms:CHEMBL1701516
TypeSmall organic molecule
Emp. Form.C21H24N4O3
Mol. Mass.380.4403
SMILESCOc1cccc(c1)C(=O)Nc1cc2n(C)c(=O)n(C)c2cc1N1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: