Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 3 |
---|
Ligand | BDBM50034554 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1439470 (CHEMBL3381247) |
---|
EC50 | 9990±n/a nM |
---|
Citation | Skidmore, J; Heer, J; Johnson, CN; Norton, D; Redshaw, S; Sweeting, J; Hurst, D; Cridland, A; Vesey, D; Wall, I; Ahmed, M; Rivers, D; Myatt, J; Giblin, G; Philpott, K; Kumar, U; Stevens, A; Bit, RA; Haynes, A; Taylor, S; Watson, R; Witherington, J; Demont, E; Heightman, TD Optimization of sphingosine-1-phosphate-1 receptor agonists: effects of acidic, basic, and zwitterionic chemotypes on pharmacokinetic and pharmacodynamic profiles. J Med Chem57:10424-42 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 3 |
---|
Name: | Sphingosine 1-phosphate receptor 3 |
Synonyms: | C9orf108 | C9orf47 | EDG3 | Endothelial differentiation G-protein coupled receptor 3 | S1P receptor 3 | S1P receptor Edg-3 | S1P3 | S1PR3 | S1PR3_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor 3 (S1P3) | Sphingosine 1-phosphate receptor Edg-3 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 42278.13 |
Organism: | Homo sapiens (Human) |
Description: | Q99500 |
Residue: | 378 |
Sequence: | MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV
ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH
NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP
SSCIMDKNAALQNGIFCN
|
|
|
BDBM50034554 |
---|
n/a |
---|
Name | BDBM50034554 |
Synonyms: | CHEMBL3359854 |
Type | Small organic molecule |
Emp. Form. | C23H25ClN4O5 |
Mol. Mass. | 472.921 |
SMILES | CC(C)Oc1ncc(cc1Cl)-c1nc(no1)-c1cccc2C(CCCC(O)=O)NCCOc12 |
Structure |
|