| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 1 |
|---|
| Ligand | BDBM50034566 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1439469 (CHEMBL3381246) |
|---|
| EC50 | 4.0±n/a nM |
|---|
| Citation |  Skidmore, J; Heer, J; Johnson, CN; Norton, D; Redshaw, S; Sweeting, J; Hurst, D; Cridland, A; Vesey, D; Wall, I; Ahmed, M; Rivers, D; Myatt, J; Giblin, G; Philpott, K; Kumar, U; Stevens, A; Bit, RA; Haynes, A; Taylor, S; Watson, R; Witherington, J; Demont, E; Heightman, TD Optimization of sphingosine-1-phosphate-1 receptor agonists: effects of acidic, basic, and zwitterionic chemotypes on pharmacokinetic and pharmacodynamic profiles. J Med Chem57:10424-42 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 1 |
|---|
| Name: | Sphingosine 1-phosphate receptor 1 |
|---|
| Synonyms: | CHEDG1 | EDG1 | Endothelial differentiation G-protein coupled receptor 1 | S1P receptor | S1P1 | S1PR1 | S1PR1_HUMAN | Sphingosine 1-phosphate receptor 1 (S1PR1) | Sphingosine 1-phosphate receptor Edg-1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 42836.02 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P21453 |
|---|
| Residue: | 382 |
|---|
| Sequence: | MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
|
|
|
|---|
| BDBM50034566 |
|---|
| n/a |
|---|
| Name | BDBM50034566 |
|---|
| Synonyms: | CHEMBL3359845 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H24N4O4 |
|---|
| Mol. Mass. | 432.4718 |
|---|
| SMILES | CC(C)Oc1ccc(cc1C#N)-c1nc(no1)-c1ccc2CCN(CC(O)=O)CCc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
