Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 4
LigandBDBM50380399
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1431998
IC50>30000±n/a nM
Citation Blackburn CBarrett CBrunson MChin JEngland DGarcia KGigstad KGould AGutierrez JHoar KRowland RSTsu CRingeling JWager KXu H Histone deacetylase inhibitors derived from 1,2,3,4-tetrahydropyrrolo[1,2-a]pyrazine and related heterocycles selective for the HDAC6 isoform. Bioorg Med Chem Lett 24:5450-4 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 4
Name:Histone deacetylase 4
Synonyms:HD4 | HDAC4 | Histone acetylase 4(HDAC4) | Human HDAC4 | KIAA0288
Type:Enzyme
Mol. Mass.:119049.39
Organism:Homo sapiens (Human)
Description:P56524
Residue:1084
Sequence:
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLP
VAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGP
SSPNNSSGSVSAENGIAPAVPSIPAETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPA
TGPSAGTAGQQDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLL
EQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHL
VIQQQHQQFLEKHKQQFQQQQLQMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPY
LDRLPGQKEAHAQAGVQVKQEPIESDEEEAEPPREVEPGQRQPSEQELLFRQQALLLEQQ
RIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPVSVQEPPTKPRFTTGLVYDT
LMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHT
LLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAVGCVVE
LVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKILIVDWD
VHHGNGTQQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDP
PMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYLTKQL
MGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKV
MEIHSKYWRCLQRTTSTAGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRPDEEPMEE
EPPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50380399
n/a
NameBDBM50380399
Synonyms:CHEMBL2018302 | Tubastatin A | US8748451, 6 | US9249087, Tubacin | US9751832, Tubastatin A
TypeSmall organic molecule
Emp. Form.C20H21N3O2
Mol. Mass.335.3996
SMILESCN1CCc2c(C1)c1ccccc1n2Cc1ccc(cc1)C(=O)NO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: