Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNonstructural protein NS3-4A
LigandBDBM12311
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1437305
Ki 14±n/a nM
Citation Lampa AAlogheli HEhrenberg AE┼kerblom ESvensson RArtursson PDanielson UHKarlÚn ASandstr÷m A Vinylated linear P2 pyrimidinyloxyphenylglycine based inhibitors of the HCV NS3/4A protease and corresponding macrocycles. Bioorg Med Chem 22:6595-615 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nonstructural protein NS3-4A
Name:Nonstructural protein NS3-4A
Synonyms:Nonstructural protein NS3-4A
Type:PROTEIN
Mol. Mass.:71633.49
Organism:Hepatitis C virus
Description:ChEMBL_109716
Residue:674
Sequence:
SPITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVFHGAG
SKTLAGPKGPITQMYTNVDQDLVGWMAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRG
DGRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFVPVESMETTMR
SPVFTDNSSPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGA
YMSKAGTDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIICDECHSTDSTTLGI
GTVLDQAETAGARLVVLATATPPGSTVPHPNIEEVALSTTGEIPFYGKAIPIETIKGGRH
LIFCHSKKKCDELAGKLSALGLNAVAYYRGLDVSVIPTSGDVVVVATDALMTGYTGDFDS
VIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRGIYRFVTPGERPSGM
FDSSVLCECYDAGCAWYELTPAETTRLRAYLNTPGLPVCQDHLEFWEGVFTGLTIDAHFL
SQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLRLKPTLHGPTPLLYRLGAVQNE
ITLTHPITKIMTCMSADLEVVTSTWVLVGGVLAALAAYCLTTGSVVIVGRIILSGRPAVP
DREVLYEFDEMEEC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM12311
n/a
NameBDBM12311
Synonyms:(1R,5S)-N-[3-Amino-1-(cyclobutylmethyl)-2,3-dioxopropyl]-3-[2(S)-[[[(1,1-dimethylethyl)amino]carbonyl]amino]-3,3-dimethyl-1-oxobutyl]-6,6-dimethyl-3-azabicyclo[3.1.0]hexan-2(S)-carboxamide | 3-{[(1R,2S,5S)-3-[(2S)-2-[(tert-butylcarbamoyl)amino]-3,3-dimethylbutanoyl]-6,6-dimethyl-3-azabicyclo[3.1.0]hexan-2-yl]formamido}-4-cyclobutyl-2-oxobutanamide | BOCEPREVIR | SCH 503034
TypeSmall organic molecule
Emp. Form.C27H45N5O5
Mol. Mass.519.6767
SMILESCC(C)(C)NC(=O)N[C@H](C(=O)N1C[C@H]2[C@@H]([C@H]1C(=O)NC(CC1CCC1)C(=O)C(N)=O)C2(C)C)C(C)(C)C |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: