Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNonstructural protein NS3-4A
LigandBDBM50336545
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1437305
Ki 1.2±n/a nM
Citation Lampa AAlogheli HEhrenberg AE┼kerblom ESvensson RArtursson PDanielson UHKarlÚn ASandstr÷m A Vinylated linear P2 pyrimidinyloxyphenylglycine based inhibitors of the HCV NS3/4A protease and corresponding macrocycles. Bioorg Med Chem 22:6595-615 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nonstructural protein NS3-4A
Name:Nonstructural protein NS3-4A
Synonyms:Nonstructural protein NS3-4A
Type:PROTEIN
Mol. Mass.:71633.49
Organism:Hepatitis C virus
Description:ChEMBL_109716
Residue:674
Sequence:
SPITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVFHGAG
SKTLAGPKGPITQMYTNVDQDLVGWMAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRG
DGRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFVPVESMETTMR
SPVFTDNSSPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGA
YMSKAGTDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIICDECHSTDSTTLGI
GTVLDQAETAGARLVVLATATPPGSTVPHPNIEEVALSTTGEIPFYGKAIPIETIKGGRH
LIFCHSKKKCDELAGKLSALGLNAVAYYRGLDVSVIPTSGDVVVVATDALMTGYTGDFDS
VIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRGIYRFVTPGERPSGM
FDSSVLCECYDAGCAWYELTPAETTRLRAYLNTPGLPVCQDHLEFWEGVFTGLTIDAHFL
SQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLRLKPTLHGPTPLLYRLGAVQNE
ITLTHPITKIMTCMSADLEVVTSTWVLVGGVLAALAAYCLTTGSVVIVGRIILSGRPAVP
DREVLYEFDEMEEC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50336545
n/a
NameBDBM50336545
Synonyms:(1R,2S)-1-((2S,4R)-4-(8-bromo-2-(2-isobutyramidothiazol-4-yl)-7-methoxyquinolin-4-yloxy)-1-((S)-2-(cyclopentyloxycarbonylamino)-3,3-dimethylbutanoyl)pyrrolidine-2-carboxamido)-2-vinylcyclopropanecarboxylic acid | CHEMBL1241348 | N-[(cyclopentyloxy)carbonyl]-3-methyl-L-valyl-(4R)-4-[(8-bromo-7-methoxy-2-{2-[(2-methylpropanoyl)amino]-1,3-thiazol-4-yl}quinolin-4-yl)oxy]-N-[(1R,2S)-1-carboxy-2-ethenylcyclopropyl]-L-prolinamide
TypeSmall organic molecule
Emp. Form.C40H49BrN6O9S
Mol. Mass.869.821
SMILESCOc1ccc2c(O[C@@H]3C[C@H](N(C3)C(=O)[C@@H](NC(=O)OC3CCCC3)C(C)(C)C)C(=O)N[C@@]3(C[C@H]3C=C)C(O)=O)cc(nc2c1Br)-c1csc(NC(=O)C(C)C)n1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: