Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
---|
Ligand | BDBM50039709 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1446026 (CHEMBL3379139) |
---|
IC50 | 830±n/a nM |
---|
Citation | Li, X; Li, L; Zhou, Q; Zhang, N; Zhang, S; Zhao, R; Liu, D; Jing, Y; Zhao, L Synthesis of the novel elemonic acid derivatives as Pin1 inhibitors. Bioorg Med Chem Lett24:5612-5 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
---|
Name: | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
Synonyms: | PIN1 | PIN1_HUMAN | PPIase Pin1 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
Type: | PROTEIN |
Mol. Mass.: | 18248.11 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1502595 |
Residue: | 163 |
Sequence: | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
|
|
|
BDBM50039709 |
---|
n/a |
---|
Name | BDBM50039709 |
Synonyms: | CHEMBL3357850 |
Type | Small organic molecule |
Emp. Form. | C36H51NO4 |
Mol. Mass. | 561.7944 |
SMILES | [H][C@]1(CC[C@]2(C)C3=C(CC[C@@]12C)[C@@]1(C)CCC(=O)C(C)(C)[C@]1([H])CC3)[C@H](CCC(=O)N(C)C)C(=O)OCc1ccccc1 |r,c:6| |
Structure |
|