| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50068452 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1443747 (CHEMBL3371720) |
|---|
| Ki | 2.2±n/a nM |
|---|
| Citation |  Xu, R; Lord, SA; Peterson, RM; Fergason-Cantrell, EA; Lever, JR; Lever, SZ Ether modifications to 1-[2-(3,4-dimethoxyphenyl)ethyl]-4-(3-phenylpropyl)piperazine (SA4503): effects on binding affinity and selectivity for sigma receptors and monoamine transporters. Bioorg Med Chem23:222-30 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM50068452 |
|---|
| n/a |
|---|
| Name | BDBM50068452 |
|---|
| Synonyms: | 1-[2-(3,4-Dichloro-phenyl)-ethyl]-4-(3-phenyl-propyl)-piperazine | CHEMBL343654 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H26Cl2N2 |
|---|
| Mol. Mass. | 377.351 |
|---|
| SMILES | Clc1ccc(CCN2CCN(CCCc3ccccc3)CC2)cc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
