Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase XIV
LigandBDBM50040427
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1443941
Ki 239±n/a nM
Citation Ceruso MAntel SVullo DScozzafava ASupuran CT Inhibition studies of new ureido-substituted sulfonamides incorporating a GABA moiety against human carbonic anhydrase isoforms I-XIV. Bioorg Med Chem 22:6768-75 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase XIV
Name:Carbonic Anhydrase XIV
Synonyms:CA-XIV | Carbonate dehydratase XIV | Carbonic anhydrase 14 | Carbonic anhydrase 14 (CA XIV) | Carbonic anhydrase XIV (CA XIV)
Type:Enzyme
Mol. Mass.:37665.67
Organism:Homo sapiens (Human)
Description:Human (cloned) isozyme.
Residue:337
Sequence:
MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPD
LPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGG
SEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSH
LHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQ
LEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVG
CLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50040427
n/a
NameBDBM50040427
Synonyms:CHEMBL3360586
TypeSmall organic molecule
Emp. Form.C18H22N4O4S
Mol. Mass.390.457
SMILESNS(=O)(=O)c1ccc(CNC(=O)CCCNC(=O)Nc2ccccc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: