Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C chemokine receptor type 3
LigandBDBM50041184
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1445729
Ki 92±n/a nM
Citation Kriegl JMMartyres DGrundl MAAnderskewitz RDollinger HRast GSchmid BSeither PTautermann CS Rodent selectivity of piperidine-4-yl-1H-indoles, a series of CC chemokine receptor-3 (CCR3) antagonists: insights from a receptor model. Bioorg Med Chem Lett 25:229-35 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-C chemokine receptor type 3
Name:C-C chemokine receptor type 3
Synonyms:C-C CKR-3 | CC-CKR-3 | CCR-3 | CCR3 | CD_antigen=CD193 | CKR3 | MIP-1 alpha RL2 | Macrophage inflammatory protein 1-alpha receptor-like 2 | Probable C-C chemokine receptor type 3
Type:PROTEIN
Mol. Mass.:41791.57
Organism:Mus musculus
Description:ChEMBL_1445729
Residue:359
Sequence:
MAFNTDEIKTVVESFETTPYEYEWAPPCEKVRIKELGSWLLPPLYSLVFIIGLLGNMMVV
LILIKYRKLQIMTNIYLFNLAISDLLFLFTVPFWIHYVLWNEWGFGHYMCKMLSGFYYLA
LYSEIFFIILLTIDRYLAIVHAVFALRARTVTFATITSIITWGLAGLAALPEFIFHESQD
SFGEFSCSPRYPEGEEDSWKRFHALRMNIFGLALPLLIMVICYSGIIKTLLRCPNKKKHK
AIRLIFVVMIVFFIFWTPYNLVLLFSAFHSTFLETSCQQSKHLDLAMQVTEVIAYTHCCI
NPVIYAFVGERFRKHLRLFFHRNVAVYLGKYIPFLPGEKMERTSSVSPSTGEQEISVVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50041184
n/a
NameBDBM50041184
Synonyms:CHEMBL3355943
TypeSmall organic molecule
Emp. Form.C23H27FN2OS
Mol. Mass.398.537
SMILESOCc1[nH]c2ccccc2c1C1CCN(CCCSc2ccc(F)cc2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: