Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor 1
LigandBDBM50158348
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1446103
EC50 0.062000±n/a nM
Citation Buzard DJKim SHLopez LKawasaki AZhu XMoody JThoresen LCalderon IUllman BHan SLehmann JGharbaoui TSengupta DCalvano LMontalban AGMa YASage CGao YSemple GEdwards JBarden JMorgan MChen WUsmani KChen CSadeque AChristopher RJThatte JFu LSolomon MMills DWhelan KAl-Shamma HGatlin JLe MGaidarov IAnthony TUnett DJBlackburn ARueter JStirn SBehan DPJones RM Discovery of APD334: Design of a Clinical Stage Functional Antagonist of the Sphingosine-1-phosphate-1 Receptor. ACS Med Chem Lett 5:1313-7 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-phosphate receptor 1
Name:Sphingosine 1-phosphate receptor
Synonyms:CHEDG1 | EDG1 | Endothelial differentiation G-protein coupled receptor 1 | S1P receptor | S1P1 | S1PR1 | Sphingosine 1-phosphate receptor 1 (S1PR1) | Sphingosine 1-phosphate receptor Edg-1
Type:Enzyme
Mol. Mass.:42836.02
Organism:Homo sapiens (Human)
Description:P21453
Residue:382
Sequence:
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50158348
n/a
NameBDBM50158348
Synonyms:(2S,3R,4E)-2-amino-3-hydroxyoctadec-4-en-1-yl dihydrogen phosphate | (2S,3R,4E)-2-amino-4-octadecene-1,3-diol 1-(dihydrogen phosphate) | CHEMBL225155 | sphingosine 1-phosphate | sphingosine-1-phosphate
TypeSmall organic molecule
Emp. Form.C18H38NO5P
Mol. Mass.379.4718
SMILESCCCCCCCCCCCCC\C=C\[C@@H](O)[C@@H](N)COP(O)(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: