Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 7
LigandBDBM50042042
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1443874
IC50 60±n/a nM
Citation Endo YKawai KAsano TAmano SAsanuma YSawada KOgura KNagata NUeo NTakahashi NSonoda YKamei N Discovery and SAR study of 2-(4-pyridylamino)thieno[3,2-d]pyrimidin-4(3H)-ones as soluble and highly potent PDE7 inhibitors. Bioorg Med Chem Lett 25:649-53 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 7
Name:3',5'-cyclic phosphodiesterase
Synonyms:Phosphodiesterase 7 (PDE7) | Phosphodiesterase 7A | Phosphodiesterase 7A (PDE7A1)
Type:Enzyme
Mol. Mass.:55514.96
Organism:Homo sapiens (Human)
Description:Q13946
Residue:482
Sequence:
MEVCYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPNPRQLSQRRGAISYDSSDQTA
LYIRMLGDVRVRSRAGFESERRGSHPYIDFRIFHSQSEIEVSVSARNIRRLLSFQRYLRS
SRFFRGTAVSNSLNILDDDYNGQAKCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSL
HGLIEYFHLDMMKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLANSVTPW
DILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFS
HLPLESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLCLEDTRHRHLVLQMALKC
ADICNPCRTWELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRHTESIANIQIGFMTYL
VEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGLQREQSSSEDTDAAFELNSQLLPQENR
LS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50042042
n/a
NameBDBM50042042
Synonyms:CHEMBL3360164
TypeSmall organic molecule
Emp. Form.C13H11FN4OS
Mol. Mass.290.316
SMILESCCn1c(Nc2ccncc2F)nc2ccsc2c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: