Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin K
LigandBDBM50042856
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1444643
IC50 19000±n/a nM
Citation Grosche PSirockin FMac Sweeney ARamage PErbel PMelkko SBernardi AHughes NEllis DCombrink KDJarousse NAltmann E Structure-based design and optimization of potent inhibitors of the adenoviral protease. Bioorg Med Chem Lett 25:438-43 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin K
Name:Cathepsin K
Synonyms:CTSK | CTSO | CTSO2 | Cathepsin O | Cathepsin O2 | Cathepsin X
Type:Enzyme
Mol. Mass.:36975.68
Organism:Homo sapiens (Human)
Description:P43235
Residue:329
Sequence:
MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIH
NLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVD
YRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGG
YMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGE
NWGNKGYILMARNKNNACGIANLASFPKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50042856
n/a
NameBDBM50042856
Synonyms:CHEMBL3354495
TypeSmall organic molecule
Emp. Form.C27H27Cl2N5O3
Mol. Mass.540.441
SMILESCN(C)CCOc1ccc(cc1C(=O)C(C)(C)c1cc(Cl)cc(Cl)c1)C(=O)NCc1ccnc(n1)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: