Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Sgk1
LigandBDBM50043877
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1445188
IC50<1.000000±n/a nM
Citation Halland NSchmidt FWeiss TSaas JLi ZCzech JDreyer MHofmeister AMertsch KDietz UStrübing CNazare M Discovery of N-[4-(1H-Pyrazolo[3,4-b]pyrazin-6-yl)-phenyl]-sulfonamides as Highly Active and Selective SGK1 Inhibitors. ACS Med Chem Lett 6:73-8 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase Sgk1
Name:Serine/threonine-protein kinase Sgk1
Synonyms:SGK1 | Serine/threonine-protein kinase Sgk1 | Serine/threonine-protein kinase Sgk1 (SGK) | Serum/glucocorticoid regulated kinase | Serum/glucocorticoid-regulated kinase 1 (SGK1)
Type:Other Protein Type
Mol. Mass.:48954.40
Organism:Homo sapiens (Human)
Description:Recombinant human SGK-1 enzyme produced in a baculovirus system.
Residue:431
Sequence:
MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKI
SQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE
EVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYIN
GGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTD
FGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSR
NTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINW
DDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLG
FSYAPPTDSFL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50043877
n/a
NameBDBM50043877
Synonyms:CHEMBL3356033
TypeSmall organic molecule
Emp. Form.C20H17ClN4O3S
Mol. Mass.428.892
SMILESCOc1ccc(Cl)c(c1)S(=O)(=O)Nc1ccc(cc1)-c1ccc2c(N)n[nH]c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: