Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin
LigandBDBM50286441
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1450737
IC50 500±n/a nM
Citation Liu LJokela JWahlsten MNowruzi BPermi PZhang YZXhaard HFewer DPSivonen K Nostosins, Trypsin Inhibitors Isolated from the Terrestrial Cyanobacterium Nostoc sp. Strain FSN. J. Nat. Prod. 77:1784-90 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Trypsin
Name:Trypsin
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:24411.24
Organism:Sus scrofa
Description:ChEMBL_1450738
Residue:231
Sequence:
FPTDDDDKIVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGE
HNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAA
GTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDS
CQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50286441
n/a
NameBDBM50286441
Synonyms:(S)-2-((S)-2-Acetylamino-4-(S)-methyl-pentanoylamino)-4-methyl-pentanoic acid (1-formyl-4-guanidino-butyl)-amide | (S)-2-Acetylamino-4-methyl-pentanoic acid [(R)-1-((S)-1-formyl-4-guanidino-butylcarbamoyl)-3-methyl-butyl]-amide | (S)-2-Acetylamino-4-methyl-pentanoic acid [(S)-1-((S)-1-formyl-4-guanidino-butylcarbamoyl)-3-methyl-butyl]-amide | (S)-2-[(S)-2-((S)-2-Acetylamino-4-methyl-pentanoylamino)-4-methyl-pentanoylamino]-5-guanidino-pentanoic acid | (S)-2-acetylamino-4-methyl-pentanoic acid [(S)-2-(1-formyl-4-guanidino-butylamino)-4-methyl-pentanoyl]-amide | 2-Acetylamino-4-methyl-pentanoic acid [1-(1-formyl-4-guanidino-butylcarbamoyl)-3-methyl-butyl]-amide | Ac-LLR-CHO | Ac-Leu-Leu-Arg-H | CHEMBL129157
TypeSmall organic molecule
Emp. Form.C20H38N6O5
Mol. Mass.442.5529
SMILESCC(C)C[C@H](NC(C)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: