Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNA repair and recombination protein RAD54-like
LigandBDBM50447758
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1446569
EC50 16500±n/a nM
Citation Huang FMazin AV Targeting the homologous recombination pathway by small molecule modulators. Bioorg Med Chem Lett 24:3006-13 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DNA repair and recombination protein RAD54-like
Name:DNA repair and recombination protein RAD54-like
Synonyms:DNA repair and recombination protein RAD54-like | RAD54 homolog | RAD54A | RAD54L | hHR54 | hRAD54
Type:PROTEIN
Mol. Mass.:84374.70
Organism:Homo sapiens (Human)
Description:ChEMBL_105125
Residue:747
Sequence:
MRRSLAPSQLAKRKPEGRSCDDEDWQPGLVTPRKRKSSSETQIQECFLSPFRKPLSQLTN
QPPCLDSSQHEAFIRSILSKPFKVPIPNYQGPLGSRALGLKRAGVRRALHDPLEKDALVL
YEPPPLSAHDQLKLDKEKLPVHVVVDPILSKVLRPHQREGVKFLWECVTSRRIPGSHGCI
MADEMGLGKTLQCITLMWTLLRQSPECKPEIDKAVVVSPSSLVKNWYNEVGKWLGGRIQP
LAIDGGSKDEIDQKLEGFMNQRGARVSSPILIISYETFRLHVGVLQKGSVGLVICDEGHR
LKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAHEFKKHFELP
ILKGRDAAASEADRQLGEERLRELTSIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQ
TELYKRFLRQAKPAEELLEGKMSVSSLSSITSLKKLCNHPALIYDKCVEEEDGFVGALDL
FPPGYSSKALEPQLSGKMLVLDYILAVTRSRSSDKVVLVSNYTQTLDLFEKLCRARRYLY
VRLDGTMSIKKRAKVVERFNSPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPAND
EQAMARVWRDGQKKTCYIYRLLSAGTIEEKIFQRQSHKKALSSCVVDEEQDVERHFSLGE
LKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVL
QAAWDAASTAITFVFHQRSHEEQRGLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50447758
n/a
NameBDBM50447758
Synonyms:CHEBI:9287 | NSC-45383 | Nigrin | Rufocromomycin | STREPTONIGRIN | Streptonigrin
TypeSmall organic molecule
Emp. Form.C25H22N4O8
Mol. Mass.506.4642
SMILESCOC1=C(N)C(=O)c2nc(ccc2C1=O)-c1nc(C(O)=O)c(C)c(c1N)-c1ccc(OC)c(OC)c1O |c:2,(25.46,-.06,;26.8,-.83,;28.13,-.06,;28.13,1.48,;26.79,2.25,;29.46,2.25,;29.46,3.79,;30.79,1.49,;32.13,2.25,;33.46,1.48,;33.46,-.05,;32.14,-.83,;30.79,-.06,;29.47,-.83,;29.47,-2.37,;34.79,2.25,;36.13,1.48,;37.47,2.26,;38.8,1.49,;40.13,2.26,;38.81,-.05,;37.46,3.79,;38.79,4.57,;36.13,4.55,;34.79,3.79,;33.46,4.56,;36.13,6.09,;37.46,6.86,;37.46,8.42,;36.12,9.19,;36.12,10.73,;37.45,11.5,;34.8,8.42,;33.46,9.18,;33.46,10.72,;34.79,6.86,;33.46,6.09,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: