| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Free fatty acid receptor 3 |
|---|
| Ligand | BDBM50044849 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1454433 (CHEMBL3365229) |
|---|
| EC50 | <31623±n/a nM |
|---|
| Citation |  Sparks, SM; Chen, G; Collins, JL; Danger, D; Dock, ST; Jayawickreme, C; Jenkinson, S; Laudeman, C; Leesnitzer, MA; Liang, X; Maloney, P; McCoy, DC; Moncol, D; Rash, V; Rimele, T; Vulimiri, P; Way, JM; Ross, S Identification of diarylsulfonamides as agonists of the free fatty acid receptor 4 (FFA4/GPR120). Bioorg Med Chem Lett24:3100-3 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Free fatty acid receptor 3 |
|---|
| Name: | Free fatty acid receptor 3 |
|---|
| Synonyms: | FFAR3_MOUSE | Ffar3 | Free fatty acid receptor 3 | G-protein coupled receptor 41 | Gm478 | Gm478 | Gpr41 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 36514.65 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_109430 |
|---|
| Residue: | 319 |
|---|
| Sequence: | MGTSFFLGNYWLFFSVYLLVFLVGLPLNVMALVVFVGKLRRRPVAVDLLLLNLTISDLLL
LLFLPFRMVEAACGMRWLLPFIFCPLSGFLFFTTIYLTSLFLTAVSIERFLSVAYPLWYK
TRPRLAQAGLVSVVCWFLASAHCSVVYITEYWGNATYSQGTNGTCYLEFREDQLAILLPV
RLEMAVVLFMVPLCITSYCYSRLVWILSRGASRRRRKRIMGLLAATLLIFFVCFGPYNMS
HVVGYVSRESPSWRSYVLLLSTLNSCIDPLVFYFSSSKFQADFHQLLGRLLRTCVPWTQQ
VSLELKVKNGEEPSKECPS
|
|
|
|---|
| BDBM50044849 |
|---|
| n/a |
|---|
| Name | BDBM50044849 |
|---|
| Synonyms: | CHEMBL3311308 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H19NO3S |
|---|
| Mol. Mass. | 305.392 |
|---|
| SMILES | COc1ccc(cc1)S(=O)(=O)Nc1c(C)cc(C)cc1C |
|---|
| Structure | 
|
|---|
Search and Browse
