Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaM kinase IV
LigandBDBM50045370
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1459854
IC50>30000±n/a nM
Citation Xiao DZhu XSofolarides MDegrado SShao NRao AChen XAslanian RFossetta JTian FTrivedi PLundell DPalani A Discovery of a novel series of potent MK2 non-ATP competitive inhibitors using 1,2-substituted azoles as cis-amide isosteres. Bioorg Med Chem Lett 24:3609-13 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CaM kinase IV
Name:CaM kinase IV
Synonyms:CAM kinase-GR | CAMK4 | CaMK IV | Calcium/calmodulin-dependent protein kinase type IV
Type:PROTEIN
Mol. Mass.:51919.87
Organism:Homo sapiens (Human)
Description:ChEMBL_1459854
Residue:473
Sequence:
MLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWV
TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQESHKASRDPS
PIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKA
VEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50045370
n/a
NameBDBM50045370
Synonyms:CHEMBL3314140
TypeSmall organic molecule
Emp. Form.C23H21ClN4O
Mol. Mass.404.892
SMILESClc1ccc(cc1)-c1ccc(o1)-c1nccn1-c1ccc(cc1)N1CCNCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: