Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKiSS-1 receptor
LigandBDBM50045516
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1448383
EC50 5.7±n/a nM
Citation Asami TNishizawa NMatsui HTakatsu YSuzuki AKiba ATerada MNishibori KNakayama MBan JMatsumoto STarui NIkeda YYamaguchi MKusaka MOhtaki TKitada C Physicochemically and pharmacokinetically stable nonapeptide KISS1 receptor agonists with highly potent testosterone-suppressive activity. J Med Chem 57:6105-15 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
KiSS-1 receptor
Name:KiSS-1 receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:42915.37
Organism:Rattus norvegicus
Description:ChEMBL_1448383
Residue:396
Sequence:
MAAEATLGPNVSWWAPSNASGCPGCGVNASDGPGSAPRPLDAWLVPLFFAALMLLGLVGN
SLVIFVICRHKHMQTVTNFYIANLAATDVTFLLCCVPFTALLYPLPTWVLGDFMCKFVNY
IQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALTVSLSIWVGSAAVSAPVLAL
HRLSPGPHTYCSEAFPSRALERAFALYNLLALYLLPLLATCACYGAMLRHLGRAAVRPAP
TDGALQGQLLAQRAGAVRTKVSRLVAAVVLLFAACWGPIQLFLVLQALGPSGAWHPRSYA
AYALKIWAHCMSYSNSALNPLLYAFLGSHFRQAFCRVCPCGPQRQRRPHASAHSDRAAPH
SVPHSRAAHPVRVRTPEPGNPVRRSPSVQDEHTAPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50045516
n/a
NameBDBM50045516
Synonyms:CHEMBL3314208
TypeSmall organic molecule
Emp. Form.C59H79N17O12
Mol. Mass.1218.3653
SMILESCNC(=N)NCCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)NNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](Cc1ccncc1)NC(=O)[C@H](N)Cc1ccc(O)cc1)[C@@H](C)O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: