Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurinergic receptor P2Y2
LigandBDBM50045597
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1455361
IC50>10000±n/a nM
Citation Yang WWang YLai AQiao JXWang TCHua JPrice LAShen HChen XQWong PCrain EWatson CHuang CSSeiffert DARehfuss RWexler RRLam PY Discovery of 4-aryl-7-hydroxyindoline-based P2Y1 antagonists as novel antiplatelet agents. J Med Chem 57:6150-64 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purinergic receptor P2Y2
Name:Purinergic receptor P2Y2
Synonyms:ATP receptor | P2U purinoceptor 1 | P2U1 | P2Y purinoceptor 2 | P2Y2 | Purinergic receptor
Type:PROTEIN
Mol. Mass.:42299.21
Organism:Homo sapiens (Human)
Description:ChEMBL_1455361
Residue:377
Sequence:
MAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVPGLCLNAVALYIFLC
RLKTWNASTTYMFHLAVSDALYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCS
ILFLTCISVHRCLGVLRPLRSLRWGRARYARRVAGAVWVLVLACQAPVLYFVTTSARGGR
VTCHDTSAPELFSRFVAYSSVMLGLLFAVPFAVILVCYVLMARRLLKPAYGTSGGLPRAK
RKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKVTRPLASANSC
LDPVLYFLAGQRLVRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSR
RTESTPAGSENTKDIRL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50045597
n/a
NameBDBM50045597
Synonyms:CHEMBL3314321 | US9428504, 152
TypeSmall organic molecule
Emp. Form.C36H35ClF2N6O2S
Mol. Mass.689.217
SMILESCC(C)(C)CN1CCC2(CN(c3c2c(c(F)cc3O)-c2ccc(F)cc2)c2ccccc2NC(=O)Nc2nc3ccc(Cl)nc3s2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: