Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurinergic receptor P2Y1
LigandBDBM50045626
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1454530
IC50 0.080000±n/a nM
Citation Yang WWang YLai AQiao JXWang TCHua JPrice LAShen HChen XQWong PCrain EWatson CHuang CSSeiffert DARehfuss RWexler RRLam PY Discovery of 4-aryl-7-hydroxyindoline-based P2Y1 antagonists as novel antiplatelet agents. J Med Chem 57:6150-64 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purinergic receptor P2Y1
Name:Purinergic receptor P2Y1
Synonyms:ATP receptor | P2Y purinoceptor 1 (P2Y1) | P2Y1 | Purinergic receptor
Type:Enzyme
Mol. Mass.:42090.25
Organism:Homo sapiens (Human)
Description:P47900
Residue:373
Sequence:
MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYIL
VFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG
DAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLIVV
VAISPILFYSGTGVRKNKTITCYDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLI
VRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFND
RVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLN
ILPEFKQNGDTSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50045626
n/a
NameBDBM50045626
Synonyms:CHEMBL3314306 | US9540323, 201 | US9540323, example 201
TypeSmall organic molecule
Emp. Form.C27H25FN4O2S
Mol. Mass.488.576
SMILESCc1nc(NC(=O)Nc2ccccc2N2CC(C)(C)c3c2c(O)ccc3-c2ccc(F)cc2)cs1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: