Reaction Details |
| Report a problem with these data |
Target | Potassium voltage-gated channel subfamily E member 1 |
---|
Ligand | BDBM50045830 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1456351 (CHEMBL3368360) |
---|
IC50 | >33000±n/a nM |
---|
Citation | Georgsson, J; Bergström, F; Nordqvist, A; Watson, MJ; Blundell, CD; Johansson, MJ; Petersson, AU; Yuan, ZQ; Zhou, Y; Kristensson, L; Kakol-Palm, D; Tyrchan, C; Wellner, E; Bauer, U; Brodin, P; Svensson Henriksson, A GPR103 antagonists demonstrating anorexigenic activity in vivo: design and development of pyrrolo[2,3-c]pyridines that mimic the C-terminal Arg-Phe motif of QRFP26. J Med Chem57:5935-48 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Potassium voltage-gated channel subfamily E member 1 |
---|
Name: | Potassium voltage-gated channel subfamily E member 1 |
Synonyms: | Delayed rectifier potassium channel subunit IsK | IKs producing slow voltage-gated potassium channel subunit beta Mink | KCNE1 | KCNE1_HUMAN | KCNQ1(Kv7.1)/KCNE1(MinK) | Minimal potassium channel | Voltage-gated potassium channel beta subunit Mink | Voltage-gated potassium channel, IKs |
Type: | PROTEIN |
Mol. Mass.: | 14676.11 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1456351 |
Residue: | 129 |
Sequence: | MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLG
IMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNT
HLPETKPSP
|
|
|
BDBM50045830 |
---|
n/a |
---|
Name | BDBM50045830 |
Synonyms: | CHEMBL3314362 |
Type | Small organic molecule |
Emp. Form. | C23H26ClN3O |
Mol. Mass. | 395.925 |
SMILES | CN(C)Cc1cc2CCN(Cc2cc1C)C(=O)c1cc2cc(Cl)ccc2n1C |
Structure |
|