Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVoltage-gated potassium channel beta subunit Mink
LigandBDBM50045831
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1456351
IC50>33000±n/a nM
Citation Georgsson JBergström FNordqvist AWatson MJBlundell CDJohansson MJPetersson AUYuan ZQZhou YKristensson LKakol-Palm DTyrchan CWellner EBauer UBrodin PSvensson Henriksson A GPR103 antagonists demonstrating anorexigenic activity in vivo: design and development of pyrrolo[2,3-c]pyridines that mimic the C-terminal Arg-Phe motif of QRFP26. J Med Chem 57:5935-48 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Voltage-gated potassium channel beta subunit Mink
Name:Voltage-gated potassium channel beta subunit Mink
Synonyms:Delayed rectifier potassium channel subunit IsK | IKs producing slow voltage-gated potassium channel subunit beta Mink | KCNQ1(Kv7.1)/KCNE1(MinK) | Minimal potassium channel | Voltage-gated potassium channel, IKs
Type:PROTEIN
Mol. Mass.:14676.11
Organism:Homo sapiens (Human)
Description:ChEMBL_1456351
Residue:129
Sequence:
MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLG
IMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNT
HLPETKPSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50045831
n/a
NameBDBM50045831
Synonyms:CHEMBL3314352
TypeSmall organic molecule
Emp. Form.C21H23BrN4O
Mol. Mass.427.338
SMILESCN(C)Cc1ccc2CN(CCc2c1)C(=O)c1cc2cc(Br)ncc2n1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: