Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGPR103
LigandBDBM50045842
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1456340
IC50 130±n/a nM
Citation Georgsson JBergström FNordqvist AWatson MJBlundell CDJohansson MJPetersson AUYuan ZQZhou YKristensson LKakol-Palm DTyrchan CWellner EBauer UBrodin PSvensson Henriksson A GPR103 antagonists demonstrating anorexigenic activity in vivo: design and development of pyrrolo[2,3-c]pyridines that mimic the C-terminal Arg-Phe motif of QRFP26. J Med Chem 57:5935-48 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GPR103
Name:GPR103
Synonyms:Pyroglutamylated RFamide peptide receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:49508.46
Organism:Homo sapiens (Human)
Description:GPR103 0 HUMAN::Q96P65
Residue:431
Sequence:
MQALNITPEQFSRLLRDHNLTREQFIALYRLRPLVYTPELPGRAKLALVLTGVLIFALAL
FGNALVFYVVTRSKAMRTVTNIFICSLALSDLLITFFCIPVTMLQNISDNWLGGAFICKM
VPFVQSTAVVTEILTMTCIAVERHQGLVHPFKMKWQYTNRRAFTMLGVVWLVAVIVGSPM
WHVQQLEIKYDFLYEKEHICCLEEWTSPVHQKIYTTFILVILFLLPLMVMLILYSKIGYE
LWIKKRVGDGSVLRTIHGKEMSKIARKKKRAVIMMVTVVALFAVCWAPFHVVHMMIEYSN
FEKEYDDVTIKMIFAIVQIIGFSNSICNPIVYAFMNENFKKNVLSAVCYCIVNKTFSPAQ
RHGNSGITMMRKKAKFSLRENPVEETKGEAFSDGNIEVKLCEQTEEKKKLKRHLALFRSE
LAENSPLDSGH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50045842
n/a
NameBDBM50045842
Synonyms:CHEMBL3314354
TypeSmall organic molecule
Emp. Form.C21H23IN4O
Mol. Mass.474.338
SMILESCN(C)Cc1ccc2CN(CCc2c1)C(=O)c1cc2cc(I)ncc2n1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: