| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Ligand | BDBM50187243 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1449353 (CHEMBL3372081) |
|---|
| IC50 | 960000±n/a nM |
|---|
| Citation |  Srivilai, J; Khorana, N; Waranuch, N; Suphrom, N; Ingkaninan, K Conformational analysis of an anti-androgenic, (E,E)-8-hydroxygermacrene B, using NOESY and dynamic NMR spectroscopy. Bioorg Med Chem Lett24:3526-9 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Name: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Synonyms: | S5A1_RAT | Srd5a1 | Steroid 5-alpha-reductase | Steroid 5-alpha-reductase 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 29788.29 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_1441437 |
|---|
| Residue: | 259 |
|---|
| Sequence: | MVPLMELDELCLLDMLVYLEGFMAFVSIVGLRSVGSPYGRYSPQWPGIRVPARPAWFIQE
LPSMAWPLYEYIRPAAARLGNLPNRVLLAMFLIHYVQRTLVFPVLIRGGKPTLLVTFVLA
FLFCTFNGYVQSRYLSQFAVYAEDWVTHPCFLTGFALWLVGMVINIHSDHILRNLRKPGE
TGYKIPRGGLFEYVSAANYFGELVEWCGFALASWSLQGVVFALFTLSTLLTRAKQHHQWY
HEKFEDYPKSRKILIPFVL
|
|
|
|---|
| BDBM50187243 |
|---|
| n/a |
|---|
| Name | BDBM50187243 |
|---|
| Synonyms: | 17-ethinyl-3,17-estradiol | 17-ethinyl-3,17-oestradiol | 17-ethinylestradiol | 17alpha-Ethinyl estradiol | 17alpha-ethynylestra-1,3,5(10)-triene-3,17beta-diol | 17alpha-ethynylestradiol | CHEMBL691 | ETHINYL ESTRADIOL | Ethinylestradiol | Ethynyl estradiol | ethinyloestradiol |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H24O2 |
|---|
| Mol. Mass. | 296.4034 |
|---|
| SMILES | C[C@]12CC[C@H]3[C@@H](CCc4cc(O)ccc34)[C@@H]1CC[C@@]2(O)C#C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
