Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor gamma
LigandBDBM7458
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1453700
EC50 24900±n/a nM
Citation Liu QYang QMHu HJYang LYang YBChou GXWang ZT Bioactive diterpenoids and flavonoids from the aerial parts of Scoparia dulcis. J Nat Prod 77:1594-600 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor gamma
Name:Peroxisome proliferator-activated receptor gamma
Synonyms:Nuclear receptor subfamily 1 group C member 3 | PPAR-gamma
Type:PROTEIN
Mol. Mass.:57593.55
Organism:Mus musculus
Description:ChEMBL_1453700
Residue:505
Sequence:
MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
DIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
QLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKNLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQL
LHVIKKTETDMSLHPLLQEIYKDLY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM7458
n/a
NameBDBM7458
Synonyms:5,7-dihydroxy-2-(4-hydroxyphenyl)-4H-chromen-4-one | 5,7-dihydroxy-2-(4-hydroxyphenyl)-chromen-4-one | Apigenin | Apigenin (2) | Apigenin (3) | Apigenin (7) | Apigenin, 13 | CHEMBL28 | Naringenin, 18 | cid_5280443
TypeSmall organic molecule
Emp. Form.C15H10O5
Mol. Mass.270.2369
SMILESOc1ccc(cc1)-c1cc(=O)c2c(O)cc(O)cc2o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: