Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor gamma
LigandBDBM23411
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1453700
EC50 16400±n/a nM
Citation Liu QYang QMHu HJYang LYang YBChou GXWang ZT Bioactive diterpenoids and flavonoids from the aerial parts of Scoparia dulcis. J Nat Prod 77:1594-600 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor gamma
Name:Peroxisome proliferator-activated receptor gamma
Synonyms:Nuclear receptor subfamily 1 group C member 3 | PPAR-gamma
Type:PROTEIN
Mol. Mass.:57593.55
Organism:Mus musculus
Description:ChEMBL_1453700
Residue:505
Sequence:
MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
DIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
QLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKNLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQL
LHVIKKTETDMSLHPLLQEIYKDLY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23411
n/a
NameBDBM23411
Synonyms:5,6,7-trihydroxy-2-(4-hydroxyphenyl)-4H-chromen-4-one | Scutellarein | Scutellarein (2) | Scutellarein (28)
Typeflavone
Emp. Form.C15H10O6
Mol. Mass.286.2363
SMILESOc1ccc(cc1)-c1cc(=O)c2c(O)c(O)c(O)cc2o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: