Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 1
LigandBDBM50047969
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1452866
Temperature298.15±n/a K
IC50 200±n/a nM
Commentsextracted
Citation Valente STrisciuoglio DDe Luca TNebbioso ALabella DLenoci ABigogno CDondio GMiceli MBrosch GDel Bufalo DAltucci LMai A 1,3,4-Oxadiazole-containing histone deacetylase inhibitors: anticancer activities in cancer cells. J Med Chem 57:6259-65 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 1
Name:Histone deacetylase 1/6
Synonyms:HD1 | Histone deacetylase 1 (HDAC1) | Human HDAC1 | RPD3L1
Type:Enzyme
Mol. Mass.:55090.27
Organism:Homo sapiens (Human)
Description:Purified from NIH 3T3 cells harboring human HDAC1 using an anti-FLAG M2 antibody.
Residue:482
Sequence:
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50047969
n/a
NameBDBM50047969
Synonyms:CHEMBL3314863
TypeSmall organic molecule
Emp. Form.C21H17N3O3
Mol. Mass.359.378
SMILESONC(=O)c1ccc(Cc2nnc(Cc3cccc4ccccc34)o2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: