Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoglyceride Lipase (MGL)
LigandBDBM50048064
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1453719
IC50>100000±n/a nM
Citation Hajdu ZNicolussi SRau MLorántfy LForgo PHohmann JCsupor DGertsch J Identification of endocannabinoid system-modulating N-alkylamides from Heliopsis helianthoides var. scabra and Lepidium meyenii. J Nat Prod 77:1663-9 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoglyceride Lipase (MGL)
Name:Monoglyceride Lipase (MGL)
Synonyms:MAG lipase | Monoacylglycerol lipase
Type:Hydrolase
Mol. Mass.:33391.67
Organism:Mus musculus (mouse)
Description:Assays were using membranes of recombinant MAG Lipase transiently transfected in COS-7 cells.
Residue:303
Sequence:
MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDE
LAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLG
HSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRID
SSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADR
LCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAG
CPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50048064
n/a
NameBDBM50048064
Synonyms:CHEMBL3314942
TypeSmall organic molecule
Emp. Form.C20H27NO
Mol. Mass.297.4345
SMILESCC#CC#CC\C=C/CCC\C=C\C=C\C(=O)NCC(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: