| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Galectin-7 |
|---|
| Ligand | BDBM21540 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1454624 (CHEMBL3361813) |
|---|
| Kd | >2000000±n/a nM |
|---|
| Citation |  Rajput, VK; Leffler, H; Nilsson, UJ; Mukhopadhyay, B Synthesis and evaluation of iminocoumaryl and coumaryl derivatized glycosides as galectin antagonists. Bioorg Med Chem Lett24:3516-20 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Galectin-7 |
|---|
| Name: | Galectin-7 |
|---|
| Synonyms: | Gal-7 | HKL-14 | LEG7_HUMAN | LGALS7 | PI7 | PIG1 | p53-induced gene 1 protein |
|---|
| Type: | Galactoside-binding protein |
|---|
| Mol. Mass.: | 15077.89 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 136 |
|---|
| Sequence: | MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEV
VFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVR
LVEVGGDVQLDSVRIF
|
|
|
|---|
| BDBM21540 |
|---|
| n/a |
|---|
| Name | BDBM21540 |
|---|
| Synonyms: | Galactose-Derived Compound 18 | N-[(2R,3R,4S,5R,6S)-3,5-dihydroxy-2-(hydroxymethyl)-6-(methylsulfanyl)oxan-4-yl]-4-methylbenzamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H21NO5S |
|---|
| Mol. Mass. | 327.396 |
|---|
| SMILES | CS[C@@H]1O[C@H](CO)[C@H](O)[C@H](NC(=O)c2ccc(C)cc2)[C@H]1O |
|---|
| Structure | 
|
|---|
Search and Browse
