| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50048106 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1454662 (CHEMBL3362216) |
|---|
| IC50 | 523±n/a nM |
|---|
| Citation |  Kumar, V; Clark, MJ; Traynor, JR; Lewis, JW; Husbands, SM Pyrrolo- and pyridomorphinans: non-selective opioid antagonists and delta opioid agonists/mu opioid partial agonists. Bioorg Med Chem22:4067-72 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50048106 |
|---|
| n/a |
|---|
| Name | BDBM50048106 |
|---|
| Synonyms: | CHEMBL611435 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H20N2O3 |
|---|
| Mol. Mass. | 336.3844 |
|---|
| SMILES | [H][C@@]12Oc3c4c(C[C@@]5([H])N(C)CC[C@@]14[C@@]5(O)Cc1cccnc21)ccc3O |r,THB:10:9:14:6.5.4| |
|---|
| Structure | 
|
|---|
Search and Browse
