Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein phosphatase non-receptor type 22
LigandBDBM22851
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1453820
IC50 1100±n/a nM
Citation Thorson MKPuerta DTCohen SMBarrios AM Inhibition of the lymphoid tyrosine phosphatase: the effect of zinc(II) ions and chelating ligand fragments on enzymatic activity. Bioorg Med Chem Lett 24:4019-22 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein phosphatase non-receptor type 22
Name:Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP
Synonyms:Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP | LyP | Lymphoid phosphatase | Lymphoid phosphatase (Lyp) | PEP | PEST-domain phosphatase | PTPN22 | PTPN8 | Tyrosine-protein phosphatase non-receptor type 22 (LYP) | tyrosine-protein phosphatase non-receptor type 22 isoform 1
Type:n/a
Mol. Mass.:91712.31
Organism:Homo sapiens (Human)
Description:Q9Y2R2
Residue:807
Sequence:
MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRY
KDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEY
SVLIIVMACMEYEMGKKKCERYWAEPGEMQLEFGPFSVSCEAEKRKSDYIIRTLKVKFNS
ETRTIYQFHYKNWPDHDVPSSIDPILELIWDVRCYQEDDSVPICIHCSAGCGRTGVICAI
DYTWMLLKDGIIPENFSVFSLIREMRTQRPSLVQTQEQYELVYNAVLELFKRQMDVIRDK
HSGTESQAKHCIPEKNHTLQADSYSPNLPKSTTKAAKMMNQQRTKMEIKESSSFDFRTSE
ISAKEELVLHPAKSSTSFDFLELNYSFDKNADTTMKWQTKAFPIVGEPLQKHQSLDLGSL
LFEGCSNSKPVNAAGRYFNSKVPITRTKSTPFELIQQRETKEVDSKENFSYLESQPHDSC
FVEMQAQKVMHVSSAELNYSLPYDSKHQIRNASNVKHHDSSALGVYSYIPLVENPYFSSW
PPSGTSSKMSLDLPEKQDGTVFPSSLLPTSSTSLFSYYNSHDSLSLNSPTNISSLLNQES
AVLATAPRIDDEIPPPLPVRTPESFIVVEEAGEFSPNVPKSLSSAVKVKIGTSLEWGGTS
EPKKFDDSVILRPSKSVKLRSPKSELHQDRSSPPPPLPERTLESFFLADEDCMQAQSIET
YSTSYPDTMENSTSSKQTLKTPGKSFTRSKSLKILRNMKKSICNSCPPNKPAESVQSNNS
SSFLNFGFANRFSKPKGPRNPPPTWNI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22851
n/a
NameBDBM22851
Synonyms:1,2-Dione-Based Compound, 8 | 1,2-dihydronaphthalene-1,2-dione | 1,2-naphthoquinone | CHEMBL52347 | cid_10667
TypeSmall organic molecule
Emp. Form.C10H6O2
Mol. Mass.158.1534
SMILESO=C1C=Cc2ccccc2C1=O |c:2|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: