| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Similar to alpha-tubulin isoform 1 |
|---|
| Ligand | BDBM50051068 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1446866 (CHEMBL3371937) |
|---|
| IC50 | 1400±n/a nM |
|---|
| Citation |  Romagnoli, R; Baraldi, PG; Salvador, MK; Prencipe, F; Bertolasi, V; Cancellieri, M; Brancale, A; Hamel, E; Castagliuolo, I; Consolaro, F; Porcù, E; Basso, G; Viola, G Synthesis, antimitotic and antivascular activity of 1-(3',4',5'-trimethoxybenzoyl)-3-arylamino-5-amino-1,2,4-triazoles. J Med Chem57:6795-808 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Similar to alpha-tubulin isoform 1 |
|---|
| Name: | Similar to alpha-tubulin isoform 1 |
|---|
| Synonyms: | Similar to alpha-tubulin isoform 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 10383.05 |
|---|
| Organism: | Bos taurus |
|---|
| Description: | ChEMBL_104716 |
|---|
| Residue: | 99 |
|---|
| Sequence: | CVSASPSTLARLVSRSAMPAGSSTAWNTAFSPMARCQVTKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRSSSTLSSSSQAKKMP
|
|
|
|---|
| BDBM50051068 |
|---|
| n/a |
|---|
| Name | BDBM50051068 |
|---|
| Synonyms: | CHEMBL3318076 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H23N5O4 |
|---|
| Mol. Mass. | 397.4277 |
|---|
| SMILES | CCc1ccc(Nc2nc(N)n(n2)C(=O)c2cc(OC)c(OC)c(OC)c2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
