Reaction Details |
| Report a problem with these data |
Target | Similar to alpha-tubulin isoform 1 |
---|
Ligand | BDBM50005480 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1446866 (CHEMBL3371937) |
---|
IC50 | 1200±n/a nM |
---|
Citation | Romagnoli, R; Baraldi, PG; Salvador, MK; Prencipe, F; Bertolasi, V; Cancellieri, M; Brancale, A; Hamel, E; Castagliuolo, I; Consolaro, F; Porcù, E; Basso, G; Viola, G Synthesis, antimitotic and antivascular activity of 1-(3',4',5'-trimethoxybenzoyl)-3-arylamino-5-amino-1,2,4-triazoles. J Med Chem57:6795-808 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Similar to alpha-tubulin isoform 1 |
---|
Name: | Similar to alpha-tubulin isoform 1 |
Synonyms: | Similar to alpha-tubulin isoform 1 |
Type: | PROTEIN |
Mol. Mass.: | 10383.05 |
Organism: | Bos taurus |
Description: | ChEMBL_104716 |
Residue: | 99 |
Sequence: | CVSASPSTLARLVSRSAMPAGSSTAWNTAFSPMARCQVTKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRSSSTLSSSSQAKKMP
|
|
|
BDBM50005480 |
---|
n/a |
---|
Name | BDBM50005480 |
Synonyms: | (-)-combretastatin | (Z)-3'-hydroxy-3,4,4',5-tetramethoxystilbene | (Z)-5-(3,4,5-trimethoxystyryl)-2-methoxyphenol | (combretastatin A-4)2-Methoxy-5-[2-(3,4,5-trimethoxy-phenyl)-vinyl]-phenol | (combretastin A-4)2-Methoxy-5-[2-(3,4,5-trimethoxy-phenyl)-vinyl]-phenol | 2-Methoxy-5-[(Z)-2-(3,4,5-trimethox y-phenyl)-vinyl]-phenol | 2-Methoxy-5-[(Z)-2-(3,4,5-trimethoxy-phenyl)-vinyl]-phenol | 2-Methoxy-5-[2-(3,4,5-trimethoxy-phenyl)-vinyl]-phenol | 2-methoxy-5-(3,4,5-trimethoxystyryl)phenol | 2-methoxy-5-[(Z)-2-(3,4,5-trimethoxyphenyl)vinyl]phenol | 5-(3,4,5-trimethoxystyryl)-2-methoxyphenol | 5-[(S)-2-Hydroxy-2-(3,4,5-trimethoxy-phenyl)-ethyl]-2-methoxy-phenol | CHEMBL67 | Combrestatin A-4 | Combrestatin A4 | Combretastastin A-4 | Combretastatin | Combretastatin-A4 | Combretastin A-4 | Z-Combretastatin A-4 | combretastatin A-4, (CSA4) | combretastin A4 |
Type | Small organic molecule |
Emp. Form. | C18H20O5 |
Mol. Mass. | 316.3484 |
SMILES | COc1ccc(\C=C/c2cc(OC)c(OC)c(OC)c2)cc1O |
Structure |
|