Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone-lysine N-methyltransferase SUV39H2 (Suv39H2)
LigandBDBM50051117
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1450368
IC50>100000±n/a nM
Citation Ma AYu WLi FBleich RMHerold JMButler KVNorris JLKorboukh VTripathy AJanzen WPArrowsmith CHFrye SVVedadi MBrown PJJin J Discovery of a selective, substrate-competitive inhibitor of the lysine methyltransferase SETD8. J Med Chem 57:6822-33 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone-lysine N-methyltransferase SUV39H2 (Suv39H2)
Name:Histone-lysine N-methyltransferase SUV39H2 (Suv39H2)
Synonyms:H3-K9-HMTase 2 | Histone H3-K9 methyltransferase 2 | Histone-lysine N-methyltransferase SUV39H2 | Lysine N-methyltransferase 1B | Su(var)3-9 homolog 2 | Suppressor of variegation 3-9 homolog 2
Type:Enzyme
Mol. Mass.:46692.47
Organism:Homo sapiens (Human)
Description:Q9H5I1
Residue:410
Sequence:
MAAVGAEARGAWCVPCLVSLDTLQELCRKEKLTCKSIGITKRNLNNYEVEYLCDYKVVKD
MEYYLVKWKGWPDSTNTWEPLQNLKCPLLLQQFSNDKHNYLSQVKKGKAITPKDNNKTLK
PAIAEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPG
ISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCP
NRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNK
GITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTR
TINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50051117
n/a
NameBDBM50051117
Synonyms:CHEMBL3318285
TypeSmall organic molecule
Emp. Form.C23H35N5O2
Mol. Mass.413.5563
SMILESCOc1cc2nc(nc(NCCCCCN3CCCC3)c2cc1OC)N1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: