Reaction Details |
| Report a problem with these data |
Target | Cannabinoid receptor 2 |
---|
Ligand | BDBM50055283 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1450475 (CHEMBL3379971) |
---|
EC50 | 701±n/a nM |
---|
Citation | Brizzi, A; Aiello, F; Marini, P; Cascio, MG; Corelli, F; Brizzi, V; De Petrocellis, L; Ligresti, A; Luongo, L; Lamponi, S; Maione, S; Pertwee, RG; Di Marzo, V Structure-affinity relationships and pharmacological characterization of new alkyl-resorcinol cannabinoid receptor ligands: Identification of a dual cannabinoid receptor/TRPA1 channel agonist. Bioorg Med Chem22:4770-83 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cannabinoid receptor 2 |
---|
Name: | Cannabinoid receptor 2 |
Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 39690.94 |
Organism: | Homo sapiens (Human) |
Description: | P34972 |
Residue: | 360 |
Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
BDBM50055283 |
---|
n/a |
---|
Name | BDBM50055283 |
Synonyms: | CHEMBL3323685 |
Type | Small organic molecule |
Emp. Form. | C28H41NO3 |
Mol. Mass. | 439.63 |
SMILES | CCCCCc1cc(O)cc(OCCCCCCCCCCC(=O)Nc2ccccc2)c1 |
Structure |
|