Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurinergic receptor P2Y12
LigandBDBM50100191
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1454020
IC50 700±n/a nM
Citation Boldron CBesse ABordes MFTissandié SYvon XGau BBadorc ARousseaux TBarré GMeneyrol JZech GNazare MFossey VPflieger AMBonnet-Lignon SMillet LBriot CDol FHérault JPSavi PLassalle GDelesque NHerbert JMBono F N-[6-(4-butanoyl-5-methyl-1H-pyrazol-1-yl)pyridazin-3-yl]-5-chloro-1-[2-(4-methylpiperazin-1-yl)-2-oxoethyl]-1H-indole-3-carboxamide (SAR216471), a novel intravenous and oral, reversible, and directly acting P2Y12 antagonist. J Med Chem 57:7293-316 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purinergic receptor P2Y12
Name:Purinergic receptor P2Y12
Synonyms:P2Y purinoceptor 12 | P2Y12
Type:PROTEIN
Mol. Mass.:39068.50
Organism:Rattus norvegicus
Description:ChEMBL_1454020
Residue:343
Sequence:
MEVPGANATSANTTSIPGTSTLCSRDYKITQVLFPLLYTVLFFAGLITNSLAMRIFFQIR
SKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGAGHLRTLVCQVTSVTFYFTMYISISF
LGLITIDRYLKTTRPFKTSSPSNLLGAKILSVAIWAFMFLLSLPNMILTNRRPKDKDITK
CSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYSLITKELYRSYVRTRGSAKAPKKRV
NIKVFIIIAVFFICFVPFHFARIPYTLSQTRAVFDCNAENTLFYVKESTLWLTSLNACLD
PFIYFFLCKSFRNSLMSMLRCSTSGANKKKGQEGGDPSEETPM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50100191
n/a
NameBDBM50100191
Synonyms:CHEMBL3325807
TypeSmall organic molecule
Emp. Form.C28H29ClN6O3
Mol. Mass.533.021
SMILESCN1CCN(CC1)C(=O)Cn1cc(C(=O)Nc2ccc(cc2)-n2ncc(C(C)=O)c2C)c2cc(Cl)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: