Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDynamin-2
LigandBDBM50055860
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1458574
IC50 14700±n/a nM
Citation MacGregor KAAbdel-Hamid MKOdell LRChau NWhiting ARobinson PJMcCluskey A Development of quinone analogues as dynamin GTPase inhibitors. Eur J Med Chem 85:191-206 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dynamin-2
Name:Dynamin-2
Synonyms:Dnm2 | Dyn2
Type:PROTEIN
Mol. Mass.:98236.76
Organism:Rattus norvegicus
Description:ChEMBL_1458574
Residue:870
Sequence:
MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLILQLIFSKTEYAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPI
NLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMD
LANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQK
DIEGRKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQQLTNHIRESLPTLRSKL
QSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGA
RINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQVVKL
KEPCLKCVDLVIQELISTVRQCTSKLSSYPRLREETERIVTTYIREREGRTKDQILLLID
IEQSYINTNHEDFIGFANAQQRSTQLNKKRAIPNQGEILVIRRGWLTINNISLMKGGSKE
YWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDL
RQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLV
DSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESAEQAQRRD
DMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQNTSSHSPTPQRRPVSSVHPPGR
PPAVRGPTPGPPLIPMPVGATSSFSAPPIPSRPGPQNVFANNDPFSAPPQIPSRPARIPP
GIPPGVPSRRAPAAPSRPTIIRPAEPSLLD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50055860
n/a
NameBDBM50055860
Synonyms:CHEMBL3329967
TypeSmall organic molecule
Emp. Form.C20H14N2O6
Mol. Mass.378.335
SMILESOC(=O)c1cccc(NC2=CC(=O)C(Nc3cccc(c3)C(O)=O)=CC2=O)c1 |c:24,t:9|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: