Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDynamin-1
LigandBDBM50055861
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1458576
IC50 200000±n/a nM
Citation MacGregor KAAbdel-Hamid MKOdell LRChau NWhiting ARobinson PJMcCluskey A Development of quinone analogues as dynamin GTPase inhibitors. Eur J Med Chem 85:191-206 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dynamin-1
Name:Dynamin-1
Synonyms:Dynamin-1
Type:PROTEIN
Mol. Mass.:97411.67
Organism:Homo sapiens (Human)
Description:ChEMBL_1458576
Residue:864
Sequence:
MGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPI
NLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSD
LANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQK
DIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKL
QSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGA
RINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKI
REPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLID
IELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDEILVIRKGWLTINNIGIMKGGSKE
YWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDY
RQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVE
TIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAE
QAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPT
PQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAP
PGVPSRSGQASPSRPESPRPPFDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50055861
n/a
NameBDBM50055861
Synonyms:CHEMBL3329968
TypeSmall organic molecule
Emp. Form.C20H14N2O6
Mol. Mass.378.335
SMILESOC(=O)c1ccc(NC2=CC(=O)C(Nc3ccc(cc3)C(O)=O)=CC2=O)cc1 |c:23,t:8|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: