| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Ligand | BDBM50056211 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1449741 (CHEMBL3378164) |
|---|
| Ki | 138±n/a nM |
|---|
| Citation |  Guo, C; Hou, X; Dong, L; Marakovits, J; Greasley, S; Dagostino, E; Ferre, R; Johnson, MC; Humphries, PS; Li, H; Paderes, GD; Piraino, J; Kraynov, E; Murray, BW Structure-based design of novel human Pin1 inhibitors (III): optimizing affinity beyond the phosphate recognition pocket. Bioorg Med Chem Lett24:4187-91 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Synonyms: | PIN1 | PIN1_HUMAN | PPIase Pin1 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18248.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1502595 |
|---|
| Residue: | 163 |
|---|
| Sequence: | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
|
|
|
|---|
| BDBM50056211 |
|---|
| n/a |
|---|
| Name | BDBM50056211 |
|---|
| Synonyms: | CHEMBL3322225 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H17FN2O3 |
|---|
| Mol. Mass. | 376.3804 |
|---|
| SMILES | OC(=O)[C@@H](Cc1cc2ccc(F)cc2[nH]1)NC(=O)c1ccc2ccccc2c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
