Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
---|
Ligand | BDBM50056219 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1449741 (CHEMBL3378164) |
---|
Ki | 196±n/a nM |
---|
Citation | Guo, C; Hou, X; Dong, L; Marakovits, J; Greasley, S; Dagostino, E; Ferre, R; Johnson, MC; Humphries, PS; Li, H; Paderes, GD; Piraino, J; Kraynov, E; Murray, BW Structure-based design of novel human Pin1 inhibitors (III): optimizing affinity beyond the phosphate recognition pocket. Bioorg Med Chem Lett24:4187-91 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
---|
Name: | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
Synonyms: | PIN1 | PIN1_HUMAN | PPIase Pin1 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
Type: | PROTEIN |
Mol. Mass.: | 18248.11 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1502595 |
Residue: | 163 |
Sequence: | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
|
|
|
BDBM50056219 |
---|
n/a |
---|
Name | BDBM50056219 |
Synonyms: | CHEMBL3322230 |
Type | Small organic molecule |
Emp. Form. | C21H17Cl2FN2O2S |
Mol. Mass. | 451.341 |
SMILES | OC(=O)C1(Cc2cc3ccc(F)cc3[nH]2)CSC(CCc2c(Cl)cccc2Cl)=N1 |c:30| |
Structure |
|