Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50058501
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1459580
Ki 5.3±n/a nM
Citation Pinna GCurzu MMDore ALazzari PRuiu SPau AMurineddu GPinna GA Tricyclic pyrazoles part 7. Discovery of potent and selective dihydrothienocyclopentapyrazole derived CB2 ligands. Eur J Med Chem 85:747-57 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CNR2 | Cannabinoid CB2 receptor | Cannabinoid receptor | mCB2
Type:Enzyme Catalytic Domain
Mol. Mass.:38220.43
Organism:MOUSE
Description:P47936
Residue:347
Sequence:
MEGCRETEVTNGSNGGLEFNPMKEYMILSSGQQIAVAVLCTLMGLLSALENMAVLYIILS
SRRLRRKPSYLFISSLAGADFLASVIFACNFVIFHVFHGVDSNAIFLLKIGSVTMTFTAS
VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALCVMWVLSALISYLPLMGWTCCPSPCS
ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHRHVATLAEHQDRQVPGIARMRLD
VRLAKTLGLVLAVLLICWFPALALMGHSLVTTLSDQVKEAFAFCSMLCLVNSMVNPIIYA
LRSGEIRSAAQHCLIGWKKYLQGLGPEGKEEGPRSSVTETEADVKTT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50058501
n/a
NameBDBM50058501
Synonyms:CHEMBL3331453
TypeSmall organic molecule
Emp. Form.C26H27Cl2N3OS
Mol. Mass.500.483
SMILESCc1csc2Cc3c(nn(c3-c12)-c1ccc(Cl)cc1Cl)C(=O)NC1[C@@]2(C)CCC(C2)C1(C)C |r,THB:22:23:26.27:29|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: