Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNA topoisomerase 4 subunit B (parE)
LigandBDBM50058509
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1448969
IC50 86±n/a nM
Citation Yule IACzaplewski LGPommier SDavies DTNarramore SKFishwick CW Pyridine-3-carboxamide-6-yl-ureas as novel inhibitors of bacterial DNA gyrase: structure based design, synthesis, SAR and antimicrobial activity. Eur J Med Chem 86:31-8 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DNA topoisomerase 4 subunit B (parE)
Name:DNA topoisomerase 4 subunit B (parE)
Synonyms:DNA topoisomerase 4 subunit B | Topoisomerase IV subunit B | grlB
Type:Enzyme
Mol. Mass.:74365.92
Organism:Staphylococcus aureus
Description:Q2FYS5
Residue:663
Sequence:
MNKQNNYSDDSIQVLEGLEAVRKRPGMYIGSTDKRGLHHLVYEIVDNSVDEVLNGYGNEI
DVTINKDGSISIEDNGRGMPTGIHKSGKPTVEVIFTVLHAGGKFGQGGYKTSGGLHGVGA
SVVNALSEWLEVEIHRDGNIYHQSFKNGGSPSSGLVKKGKTKKTGTKVTFKPDDTIFKAS
TSFNFDVLSERLQESAFLLKNLKITLNDLRSGKERQEHYHYEEGIKEFVSYVNEGKEVLH
DVATFSGEANGIEVDVAFQYNDQYSESILSFVNNVRTKDGGTHEVGFKTAMTRVFNDYAR
RINELKTKDKNLDGNDIREGLTAVVSVRIPEELLQFEGQTKSKLGTSEARSAVDSVVADK
LPFYLEEKGQLSKSLVKKAIKAQQAREAARKAREDARSGKKNKRKDTLLSGKLTPAQSKN
TEKNELYLVEGDSAGGSAKLGRDRKFQAILPLRGKVINTEKARLEDIFKNEEINTIIHTI
GAGVGTDFKIEDSNYNRVIIMTDADTDGAHIQVLLLTFFFKYMKPLVQAGRVFIALPPLY
KLEKGKGKTKRVEYAWTDEELNKLQKELGKGFTLQRYKGLGEMNPEQLWETTMNPETRTL
IRVQVEDEVRSSKRVTTLMGDKVQPRREWIEKHVEFGMQEDQSILDNSEVQVLENDQFDE
EEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50058509
n/a
NameBDBM50058509
Synonyms:CHEMBL3329317
TypeSmall organic molecule
Emp. Form.C20H20N6O3
Mol. Mass.392.4112
SMILESCCNC(=O)Nc1cc(Nc2ccc(O)cc2)c(cn1)C(=O)Nc1cccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: