| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50058936 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1460987 (CHEMBL3394962) |
|---|
| Ki | 91000±n/a nM |
|---|
| Citation |  Ung, PM; Dunbar, JB; Gestwicki, JE; Carlson, HA An allosteric modulator of HIV-1 protease shows equipotent inhibition of wild-type and drug-resistant proteases. J Med Chem57:6468-78 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50058936 |
|---|
| n/a |
|---|
| Name | BDBM50058936 |
|---|
| Synonyms: | CHEMBL3393116 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H7N3O4S2 |
|---|
| Mol. Mass. | 357.364 |
|---|
| SMILES | [O-][N+](=O)c1cccc2C(=O)N(C(=O)c12)c1ccc2[nH]c(=S)sc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
