Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50061382 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1461562 (CHEMBL3396803) |
---|
EC50 | 1850±n/a nM |
---|
Citation | Sasmal, PK; Krishna, CV; Adabala, SS; Roshaiah, M; Rawoof, KA; Thadi, E; Sukumar, KP; Cheera, S; Abbineni, C; Rao, KV; Prasanthi, A; Nijhawan, K; Jaleel, M; Iyer, LR; Chaitanya, TK; Tiwari, NK; Krishna, NL; Potluri, V; Khanna, I; Frimurer, TM; Lückmann, M; Rist, Ø; Elster, L; Högberg, T Optimisation of in silico derived 2-aminobenzimidazole hits as unprecedented selective kappa opioid receptor agonists. Bioorg Med Chem Lett25:887-92 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50061382 |
---|
n/a |
---|
Name | BDBM50061382 |
Synonyms: | CHEMBL3394006 |
Type | Small organic molecule |
Emp. Form. | C20H21ClN4O2 |
Mol. Mass. | 384.859 |
SMILES | O[C@H]1CCN(CCn2c(NC(=O)c3ccc(Cl)cc3)nc3ccccc23)C1 |r| |
Structure |
|