Reaction Details |
| Report a problem with these data |
Target | Growth hormone secretagogue receptor type 1 |
---|
Ligand | BDBM50061716 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1461883 (CHEMBL3396113) |
---|
Ki | 263±n/a nM |
---|
Citation | Orr, ST; Beveridge, R; Bhattacharya, SK; Cameron, KO; Coffey, S; Fernando, D; Hepworth, D; Jackson, MV; Khot, V; Kosa, R; Lapham, K; Loria, PM; McClure, KF; Patel, J; Rose, C; Saenz, J; Stock, IA; Storer, G; von Volkenburg, M; Vrieze, D; Wang, G; Xiao, J; Zhang, Y Evaluation and synthesis of polar aryl- and heteroaryl spiroazetidine-piperidine acetamides as ghrelin inverse agonists. ACS Med Chem Lett6:156-61 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Growth hormone secretagogue receptor type 1 |
---|
Name: | Growth hormone secretagogue receptor type 1 |
Synonyms: | GH-releasing peptide receptor | GHRP | GHS-R | GHSR | GHSR_HUMAN | Ghrelin Receptor (Growth Hormone Secretagogue Receptor Type 1) | Ghrelin receptor | Ghrelin receptor 1a (GHS-R1a) |
Type: | Receptor |
Mol. Mass.: | 41334.57 |
Organism: | Homo sapiens (Human) |
Description: | Receptor binding studies use plasma membranes from LLC PK-1 cells transiently transfected with hGHSR1a. |
Residue: | 366 |
Sequence: | MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
|
|
|
BDBM50061716 |
---|
n/a |
---|
Name | BDBM50061716 |
Synonyms: | CHEMBL3394202 |
Type | Small organic molecule |
Emp. Form. | C30H34N6O3 |
Mol. Mass. | 526.6294 |
SMILES | COc1cc(C(N)=O)c(CC(=O)N2CCC3(CN(C3)[C@@H]3CCc4cc(ccc34)-c3nccc(C)n3)CC2)cn1 |r| |
Structure |
|