Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target2-heptyl-4(1H)-quinolone synthase PqsD
LigandBDBM50062149
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1462635
IC50 14000±n/a nM
Citation Allegretta GWeidel EEmpting MHartmann RW Catechol-based substrates of chalcone synthase as a scaffold for novel inhibitors of PqsD. Eur J Med Chem 90:351-9 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
2-heptyl-4(1H)-quinolone synthase PqsD
Name:2-heptyl-4(1H)-quinolone synthase PqsD
Synonyms:2-heptyl-4(1H)-quinolone synthase PqsD | 3-oxoacyl-(Acyl carrier protein) synthase III | 3-oxoacyl-ACP synthase | ERS445055_04170 | PA8380_44470 | PAE221_04722 | PQB biosynthetic 3-oxoacyl-[acyl-carrier-protein] synthase III | YQ19_24710 | pqsD
Type:PROTEIN
Mol. Mass.:36357.84
Organism:Pseudomonas aeruginosa
Description:ChEMBL_109728
Residue:337
Sequence:
MGNPILAGLGFSLPKRQVSNHDLVGRINTSDEFIVERTGVRTRYHVEPEQAVSALMVPAA
RQAIEAAGLLPEDIDLLLVNTLSPDHHDPSQACLIQPLLGLRHIPVLDIRAQCSGLLYGL
QMARGQILAGLARHVLVVCGEVLSKRMDCSDRGRNLSILLGDGAGAVVVSAGESLDDGLL
DLRLGADGNYFDLLMTAAPGSASPTFLDENVLREGGGEFLMRGRPMFEHASQTLVRIAGE
MLAAHELTLDDIDHVICHQPNLRILDAVQEQLGIPQHKFAVTVDRLGNMASASTPVTLAM
FWPDIQPGQRVLVLTYGSGATWGAALYRKPEEVNRPC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50062149
n/a
NameBDBM50062149
Synonyms:CHEMBL3093471
TypeSmall organic molecule
Emp. Form.C11H14O4
Mol. Mass.210.2265
SMILESCCOC(=O)CCc1ccc(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: