Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome CYP26A1
LigandBDBM50176808
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1462611
IC50 2450±n/a nM
Citation Zhao DSun BRen JLi FSong SLv XHao CCheng M Synthesis and biological evaluation of 3-phenyl-3-aryl carboxamido propanoic acid derivatives as small molecule inhibitors of retinoic acid 4-hydroxylase (CYP26A1). Bioorg Med Chem 23:1356-65 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome CYP26A1
Name:Cytochrome CYP26A1
Synonyms:Cytochrome P450 26A1 | Cytochrome P450 retinoic acid-inactivating 1 | Retinoic acid 4-hydroxylase
Type:Enzyme
Mol. Mass.:56216.16
Organism:Homo sapiens (Human)
Description:O43174
Residue:497
Sequence:
MGLPALLASALCTFVLPLLLFLAAIKLWDLYCVSGRDRSCALPLPPGTMGFPFFGETLQM
VLQRRKFLQMKRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTIL
GSGCLSNLHDSSHKQRKKVIMRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPE
VKRLMFRIAMRILLGCEPQLAGDGDSEQQLVEAFEEMTRNLFSLPIDVPFSGLYRGMKAR
NLIHARIEQNIRAKICGLRASEAGQGCKDALQLLIEHSWERGERLDMQALKQSSTELLFG
GHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQDNKLDMEILEQLKYIGCVI
KETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFM
LPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLNGPPTMKTSPTV
YPVDNLPARFTHFHGEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50176808
n/a
NameBDBM50176808
Synonyms:5-[(3-Chloro-phenyl)-imidazol-1-yl-methyl]-1H-benzoimidazole | 6-((3-chlorophenyl)(1H-imidazol-1-yl)methyl)-1H-benzo[d]imidazole | CHEMBL389433 | US9138393, Liarizole hydrochloride | US9144538, Liarizole hydrochloride | liarozole
TypeSmall organic molecule
Emp. Form.C17H13ClN4
Mol. Mass.308.765
SMILESClc1cccc(c1)C(c1ccc2nc[nH]c2c1)n1ccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: